PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D13G0784
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 436aa    MW: 48444.8 Da    PI: 7.1179
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D13G0784genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.23e-16138183147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+++G+ +W++Ia+++  gR++k+c++rw++ 
      Gh_D13G0784 138 RGHWRPAEDTKLKELVALYGPQNWNLIAEKLE-GRSGKSCRLRWFNQ 183
                      899*****************************.***********996 PP

2Myb_DNA-binding57.33.7e-18190233146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++T+eE+e+l +a++++G++ W+ Iar ++ gRt++ +k++w+ 
      Gh_D13G0784 190 RRAFTEEEEERLMQAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 233
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.201133184IPR017930Myb domain
SMARTSM007173.3E-14137186IPR001005SANT/Myb domain
SuperFamilySSF466893.37E-28138231IPR009057Homeodomain-like
PfamPF002497.5E-16138183IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.0E-25139191IPR009057Homeodomain-like
CDDcd001674.08E-13141182No hitNo description
PROSITE profilePS5129427.592185239IPR017930Myb domain
SMARTSM007178.2E-15189237IPR001005SANT/Myb domain
PfamPF002495.9E-15190232IPR001005SANT/Myb domain
CDDcd001675.00E-12192232No hitNo description
Gene3DG3DSA:1.10.10.604.4E-21192238IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MNRPGCYSTT IPSSSSSSLG SSMGMVYPDM GSLSLGQNYS ILGSSVSSTQ DSYGCKVPEM  60
ENERASWGFH FMGNCKTRSF EENHSSDVVE GQSSDCSDGF GDDSRTINLN AILNEENPND  120
NTVSGKETDS GQSKLCARGH WRPAEDTKLK ELVALYGPQN WNLIAEKLEG RSGKSCRLRW  180
FNQLDPRINR RAFTEEEEER LMQAHRLYGN KWAMIARLFP GRTDNAVKNH WHVIMARKYR  240
EQSTAYRRRK LSQSVYRKME ETPNFVCRDA ATKAEPPPYC LNIPNRRLGT ISHYQFGTFN  300
GANAGVNGGS NVSPDSSSEV PRKGFIAQQP PFDFIPGVKS NDMMGIFSQT RSWDRPIDEP  360
QISGFYPHQH HHPSYIMAMQ QSEFLSSQGL TDSTAPTAQI SGSEPSSSVP GTKAATSSHY  420
ETVPPPFIDF LGVGAI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-341382387107B-MYB
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.238550.0boll
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00222DAPTransfer from AT1G69560Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0527270.0KM052727.1 Gossypium hirsutum LOF-like transcription factor LOF3 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012465930.10.0PREDICTED: transcription factor MYB108-like
TrEMBLA0A0D2SAT50.0A0A0D2SAT5_G
STRINGVIT_01s0026g02600.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12102896
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.11e-77myb domain protein 105